SCOPe 2.08: Domain d5ecme1: 5ecm E:4-83

Lineage for d5ecme1 (5ecm E:4-83)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (34 PDB entries)

8. Domain d5ecme1: 5ecm E:4-83 [324794]
   Other proteins in same PDB: d5ecmb2, d5ecmc2, d5ecme2, d5ecmf2
   automated match to d3fhsa3
   complexed with gsh, jaa, leu

Details for d5ecme1

PDB Entry: 5ecm, 1.6 Å

PDB Description: crystal structure of fin219-fip1 complex with ja and leu

PDB Compounds: (E:) Glutathione S-transferase U20

SCOPe Domain Sequences for d5ecme1:

Sequence; same for both SEQRES and ATOM records:

>d5ecme1 c.47.1.0 (E:4-83) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lpilldywpsmfgmrarvalrekgvefeyreedfsnksplllqsnpihkkipvlvhngkp
vceslnvvqyvdeawpeknp

Timeline for d5ecme1:

• d5ecme1 first appeared in SCOPe 2.06
  
• d5ecme1 appears in SCOPe 2.07