Lineage for d5t9ce_ (5t9c E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839880Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2839967Family c.1.18.0: automated matches [191539] (1 protein)
    not a true family
  6. 2839968Protein automated matches [190919] (11 species)
    not a true protein
  7. 2839976Species Bacillus subtilis [TaxId:224308] [324756] (3 PDB entries)
  8. 2839977Domain d5t9ce_: 5t9c E: [324785]
    automated match to d2pz0b_
    complexed with ca, g3p, na, po4

Details for d5t9ce_

PDB Entry: 5t9c (more details), 1.48 Å

PDB Description: crystal structure of b. subtilis 168 glpq in complex with glycerol-3- phosphate (1 hour soak)
PDB Compounds: (E:) Glycerophosphoryl diester phosphodiesterase

SCOPe Domain Sequences for d5t9ce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t9ce_ c.1.18.0 (E:) automated matches {Bacillus subtilis [TaxId: 224308]}
nllspdriltvahrgasgyvpehtilsyetaqkmkadfieldlqmtkdgklivmhdekld
rttngmgwvkdhtladikkldagswfneaypekakpqyvglkvptleevldrfgkhanyy
ietkspdtypgmeekliaslqkhkllgkhskpgqviiqsfskeslvkvhqlqpnlptvql
leakqmasmtdaaleeiktyavgagpdykalnqenvrmirshglllhpytvnneadmhrl
ldwgvtgvftnypdlfhkvkkgy

SCOPe Domain Coordinates for d5t9ce_:

Click to download the PDB-style file with coordinates for d5t9ce_.
(The format of our PDB-style files is described here.)

Timeline for d5t9ce_: