Lineage for d5jy3d_ (5jy3 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012913Protein automated matches [190059] (14 species)
    not a true protein
  7. 2012935Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2013220Domain d5jy3d_: 5jy3 D: [324763]
    automated match to d1p8da_
    complexed with 6ox, bu1

Details for d5jy3d_

PDB Entry: 5jy3 (more details), 2.4 Å

PDB Description: crystal structure of lxrbeta (nuclear receptor subfamily 1, group h, member 2) complexed with bms-852927
PDB Compounds: (D:) oxysterols receptor lxr-beta

SCOPe Domain Sequences for d5jy3d_:

Sequence, based on SEQRES records: (download)

>d5jy3d_ a.123.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrfahftelaiis
vqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskd
dfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqp
yveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd

Sequence, based on observed residues (ATOM records): (download)

>d5jy3d_ a.123.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qltaaqelmiqqlvaaqlqcnkrkvtpwprdarqqrfahftelaiisvqeivdfakqvpg
flqlgredqiallkastieimlletarrynhetecitflkdftyskddfhraglqvefin
pifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveallsytrikr
pqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd

SCOPe Domain Coordinates for d5jy3d_:

Click to download the PDB-style file with coordinates for d5jy3d_.
(The format of our PDB-style files is described here.)

Timeline for d5jy3d_: