SCOP 1.73: Domain d1cu1b3: 1cu1 B:1326-1631

Lineage for d1cu1b3 (1cu1 B:1326-1631)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (3 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein HCV helicase domain [52725] (1 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (6 PDB entries)

8. Domain d1cu1b3: 1cu1 B:1326-1631 [32474]
   Other proteins in same PDB: d1cu1a1, d1cu1b1
   complexed with po4, zn

Details for d1cu1b3

PDB Entry: 1cu1, 2.5 Å

PDB Description: crystal structure of an enzyme complex from hepatitis c virus

PDB Compounds: (B:) protein (protease/helicase ns3)

SCOP Domain Sequences for d1cu1b3:

Sequence; same for both SEQRES and ATOM records:

>d1cu1b3 c.37.1.14 (B:1326-1631) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
pgsvtvphpnieevalsntgeipfygkaipieairggrhlifchskkkcdelaaklsglg
inavayyrgldvsviptigdvvvvatdalmtgytgdfdsvidcntcvtqtvdfsldptft
ietttvpqdavsrsqrrgrtgrgrrgiyrfvtpgerpsgmfdssvlcecydagcawyelt
paetsvrlraylntpglpvcqdhlefwesvftglthidahflsqtkqagdnfpylvayqa
tvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevtlthpitkyimacmsa
dlevvt

Timeline for d1cu1b3:

• d1cu1b3 first appeared (with stable ids) in SCOP 1.55
  
• d1cu1b3 appears in SCOP 1.71
  
• d1cu1b3 appears in SCOP 1.75
  
• d1cu1b3 appears in the current release, SCOPe 2.08