Lineage for d1cu1b3 (1cu1 B:1326-1631)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870435Family c.37.1.14: RNA helicase [52724] (7 proteins)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 2870448Protein HCV helicase domain, C-terminal domain [418963] (1 species)
  7. 2870449Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [419425] (15 PDB entries)
  8. 2870475Domain d1cu1b3: 1cu1 B:1326-1631 [32474]
    Other proteins in same PDB: d1cu1a1, d1cu1a2, d1cu1b1, d1cu1b2
    complexed with po4, zn
    has additional subdomain(s) that are not in the common domain

Details for d1cu1b3

PDB Entry: 1cu1 (more details), 2.5 Å

PDB Description: crystal structure of an enzyme complex from hepatitis c virus
PDB Compounds: (B:) protein (protease/helicase ns3)

SCOPe Domain Sequences for d1cu1b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cu1b3 c.37.1.14 (B:1326-1631) HCV helicase domain, C-terminal domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
pgsvtvphpnieevalsntgeipfygkaipieairggrhlifchskkkcdelaaklsglg
inavayyrgldvsviptigdvvvvatdalmtgytgdfdsvidcntcvtqtvdfsldptft
ietttvpqdavsrsqrrgrtgrgrrgiyrfvtpgerpsgmfdssvlcecydagcawyelt
paetsvrlraylntpglpvcqdhlefwesvftglthidahflsqtkqagdnfpylvayqa
tvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevtlthpitkyimacmsa
dlevvt

SCOPe Domain Coordinates for d1cu1b3:

Click to download the PDB-style file with coordinates for d1cu1b3.
(The format of our PDB-style files is described here.)

Timeline for d1cu1b3: