Lineage for d5kkcc2 (5kkc C:160-329)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2999256Protein automated matches [226882] (10 species)
    not a true protein
  7. 2999410Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225719] (6 PDB entries)
  8. 2999429Domain d5kkcc2: 5kkc C:160-329 [324735]
    Other proteins in same PDB: d5kkca1, d5kkcb1, d5kkcc1, d5kkcd1
    automated match to d4i9ha2
    complexed with 6v0, so4

Details for d5kkcc2

PDB Entry: 5kkc (more details), 1.86 Å

PDB Description: l-lactate dehydrogenase from rabbit muscle with the inhibitor 6dhnad
PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5kkcc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kkcc2 d.162.1.1 (C:160-329) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt
dadkeqwkqvhkqvvdsayeviklkgytswaiglsvadlaesimknlrrvhpistmikgl
ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkel

SCOPe Domain Coordinates for d5kkcc2:

Click to download the PDB-style file with coordinates for d5kkcc2.
(The format of our PDB-style files is described here.)

Timeline for d5kkcc2: