Lineage for d5tb5d_ (5tb5 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765599Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 2765600Protein GMP-PDE delta [74846] (1 species)
  7. 2765601Species Human (Homo sapiens) [TaxId:9606] [74847] (25 PDB entries)
  8. 2765615Domain d5tb5d_: 5tb5 D: [324732]
    automated match to d4jv8b_
    complexed with edo, far, gdp

Details for d5tb5d_

PDB Entry: 5tb5 (more details), 2 Å

PDB Description: crystal structure of full-length farnesylated and methylated kras4b in complex with pde-delta (crystal form i - with partially disordered hypervariable region)
PDB Compounds: (D:) Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta

SCOPe Domain Sequences for d5tb5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tb5d_ b.1.18.8 (D:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
derareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsreln
fssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpasvlt
gnviietkffdddllvstsrvrlfyv

SCOPe Domain Coordinates for d5tb5d_:

Click to download the PDB-style file with coordinates for d5tb5d_.
(The format of our PDB-style files is described here.)

Timeline for d5tb5d_: