SCOP 1.61: Domain d1cu1b2: 1cu1 B:1187-1325

Lineage for d1cu1b2 (1cu1 B:1187-1325)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families)

5. Family c.37.1.14: RNA helicase [52724] (1 protein)

6. Protein HCV helicase domain [52725] (1 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (5 PDB entries)

8. Domain d1cu1b2: 1cu1 B:1187-1325 [32473]
   Other proteins in same PDB: d1cu1a1, d1cu1b1

Details for d1cu1b2

PDB Entry: 1cu1, 2.5 Å

PDB Description: crystal structure of an enzyme complex from hepatitis c virus

SCOP Domain Sequences for d1cu1b2:

Sequence; same for both SEQRES and ATOM records:

>d1cu1b2 c.37.1.14 (B:1187-1325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates}
nssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskah
gidpnirtgvrtittgapvtystygkfladggcsggaydiiicdechstdsttilgigtv
ldqaetagarlvvlatatp

Timeline for d1cu1b2:

• d1cu1b2 first appeared (with stable ids) in SCOP 1.55
  
• d1cu1b2 appears in SCOP 1.59
  
• d1cu1b2 appears in SCOP 1.63
  
• d1cu1b2 appears in the current release, SCOPe 2.08