Lineage for d1cu1b2 (1cu1 B:1187-1325)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 70389Family c.37.1.14: RNA helicase [52724] (1 protein)
  6. 70390Protein HCV helicase domain [52725] (1 species)
  7. 70391Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (4 PDB entries)
  8. 70400Domain d1cu1b2: 1cu1 B:1187-1325 [32473]
    Other proteins in same PDB: d1cu1a1, d1cu1b1

Details for d1cu1b2

PDB Entry: 1cu1 (more details), 2.5 Å

PDB Description: crystal structure of an enzyme complex from hepatitis c virus

SCOP Domain Sequences for d1cu1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cu1b2 c.37.1.14 (B:1187-1325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates}
nssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskah
gidpnirtgvrtittgapvtystygkfladggcsggaydiiicdechstdsttilgigtv
ldqaetagarlvvlatatp

SCOP Domain Coordinates for d1cu1b2:

Click to download the PDB-style file with coordinates for d1cu1b2.
(The format of our PDB-style files is described here.)

Timeline for d1cu1b2: