Lineage for d1cu1a3 (1cu1 A:326-631)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23751Family c.37.1.14: RNA helicase [52724] (1 protein)
  6. 23752Protein HCV helicase domain [52725] (1 species)
  7. 23753Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (4 PDB entries)
  8. 23761Domain d1cu1a3: 1cu1 A:326-631 [32472]
    Other proteins in same PDB: d1cu1a1, d1cu1b1

Details for d1cu1a3

PDB Entry: 1cu1 (more details), 2.5 Å

PDB Description: crystal structure of an enzyme complex from hepatitis c virus

SCOP Domain Sequences for d1cu1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cu1a3 c.37.1.14 (A:326-631) HCV helicase domain {Human hepatitis C virus (HCV), different isolates}
pgsvtvphpnieevalsntgeipfygkaipieairggrhlifchskkkcdelaaklsglg
inavayyrgldvsviptigdvvvvatdalmtgytgdfdsvidcntcvtqtvdfsldptft
ietttvpqdavsrsqrrgrtgrgrrgiyrfvtpgerpsgmfdssvlcecydagcawyelt
paetsvrlraylntpglpvcqdhlefwesvftglthidahflsqtkqagdnfpylvayqa
tvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevtlthpitkyimacmsa
dlevvt

SCOP Domain Coordinates for d1cu1a3:

Click to download the PDB-style file with coordinates for d1cu1a3.
(The format of our PDB-style files is described here.)

Timeline for d1cu1a3: