Lineage for d8ohm_2 (8ohm 326-624)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394820Family c.37.1.14: RNA helicase [52724] (1 protein)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 394821Protein HCV helicase domain [52725] (1 species)
  7. 394822Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (6 PDB entries)
  8. 394834Domain d8ohm_2: 8ohm 326-624 [32470]

Details for d8ohm_2

PDB Entry: 8ohm (more details), 2.3 Å

PDB Description: crystal structure of rna helicase from genotype 1b hepatitis c virus: mechanism of unwinding duplex rna

SCOP Domain Sequences for d8ohm_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d8ohm_2 c.37.1.14 (326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates}
pgsvtvphpnieevalsntgeipfygkaipievirggrhlifchskkkcdelaaklsalg
lnavayyrgldvsviptsgdvvvvatdalmtgytgdfdsvidcntcvtqtvdfsldptft
idtttvpqdavsrsqrrgrtgrgrrgiyrfvtpgerpsgmfdssvlcecydagcawyelt
paetsvrlraylntpglpvcqdhlefwesvftglthidahflsqtkqagdnfpylvayqa
tvcaraqapppswdqmwksltrlkptlhgptpllyrlgalqnevtlthpvtkfimacms

SCOP Domain Coordinates for d8ohm_2:

Click to download the PDB-style file with coordinates for d8ohm_2.
(The format of our PDB-style files is described here.)

Timeline for d8ohm_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d8ohm_1