SCOP 1.59: Domain d8ohm_2: 8ohm 326-624

Lineage for d8ohm_2 (8ohm 326-624)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families)

5. Family c.37.1.14: RNA helicase [52724] (1 protein)

6. Protein HCV helicase domain [52725] (1 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (4 PDB entries)

8. Domain d8ohm_2: 8ohm 326-624 [32470]

Details for d8ohm_2

PDB Entry: 8ohm, 2.3 Å

PDB Description: crystal structure of rna helicase from genotype 1b hepatitis c virus: mechanism of unwinding duplex rna

SCOP Domain Sequences for d8ohm_2:

Sequence; same for both SEQRES and ATOM records:

>d8ohm_2 c.37.1.14 (326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates}
pgsvtvphpnieevalsntgeipfygkaipievirggrhlifchskkkcdelaaklsalg
lnavayyrgldvsviptsgdvvvvatdalmtgytgdfdsvidcntcvtqtvdfsldptft
idtttvpqdavsrsqrrgrtgrgrrgiyrfvtpgerpsgmfdssvlcecydagcawyelt
paetsvrlraylntpglpvcqdhlefwesvftglthidahflsqtkqagdnfpylvayqa
tvcaraqapppswdqmwksltrlkptlhgptpllyrlgalqnevtlthpvtkfimacms

Timeline for d8ohm_2:

• d8ohm_2 first appeared (with stable ids) in SCOP 1.55
  
• d8ohm_2 appears in SCOP 1.57
  
• d8ohm_2 appears in SCOP 1.61
  
• d8ohm_2 appears in the current release, SCOPe 2.08, called d8ohma2