Lineage for d5egnc_ (5egn C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2903183Species Uncultured bacterium [TaxId:77133] [196706] (50 PDB entries)
  8. 2903283Domain d5egnc_: 5egn C: [324695]
    automated match to d2xuah_

Details for d5egnc_

PDB Entry: 5egn (more details), 2.64 Å

PDB Description: est816 as an n-acyl homoserine lactone degrading enzyme
PDB Compounds: (C:) esterase

SCOPe Domain Sequences for d5egnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5egnc_ c.69.1.0 (C:) automated matches {Uncultured bacterium [TaxId: 77133]}
phvendgvkiyydsygegvpivflhpfstnggiwyfqtfpfaqtnhvividhrghgrsdk
patgysimehaddvvavldalkvdravfvgnsiggmiamqlnldhpqrvignlilssgtg
lgegmppeagaafqndyigafggllegavsarskrerpeilavmkahfsvpsnfpkhvfd
aatadpngvfawnikdrlssiqaptlvvageedlvttvannqlladnipgaelrvindvg
hfyqlerpsefnellrgfv

SCOPe Domain Coordinates for d5egnc_:

Click to download the PDB-style file with coordinates for d5egnc_.
(The format of our PDB-style files is described here.)

Timeline for d5egnc_: