Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) |
Family c.37.1.14: RNA helicase [52724] (1 protein) |
Protein HCV helicase domain [52725] (1 species) |
Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (4 PDB entries) |
Domain d8ohm_1: 8ohm 190-325 [32469] |
PDB Entry: 8ohm (more details), 2.3 Å
SCOP Domain Sequences for d8ohm_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d8ohm_1 c.37.1.14 (190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates} ppavpqtfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgvymskahgid pnirtgvraittggpitystygkfladggcsggaydiiicdechstdstsilgigtvldq aetagarlvvlatatp
Timeline for d8ohm_1: