Lineage for d8ohm_1 (8ohm 190-325)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.14: RNA helicase [52724] (1 protein) Protein HCV helicase domain [52725] (1 species) Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (4 PDB entries) 
Domain d8ohm_1: 8ohm 190-325 [32469]
Details for d8ohm_1
PDB Entry: 8ohm (more details), 2.3 Å
PDB Description: crystal structure of rna helicase from genotype 1b hepatitis c virus: mechanism of unwinding duplex rna
SCOP Domain Sequences for d8ohm_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d8ohm_1 c.37.1.14 (190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates}
ppavpqtfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgvymskahgid
pnirtgvraittggpitystygkfladggcsggaydiiicdechstdstsilgigtvldq
aetagarlvvlatatp
SCOP Domain Coordinates for d8ohm_1:
Click to download the PDB-style file with coordinates for d8ohm_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d8ohm_1:
- d8ohm_1 appears in SCOP 1.57
- d8ohm_1 appears in the current release, SCOPe 2.08, called d8ohma1
View in 3D
