Lineage for d5fhzc_ (5fhz C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481726Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2481727Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2482164Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2482165Protein automated matches [190683] (56 species)
    not a true protein
  7. 2482355Species Human (Homo sapiens) [TaxId:9606] [225691] (20 PDB entries)
  8. 2482422Domain d5fhzc_: 5fhz C: [324683]
    automated match to d3u4jb_
    complexed with nad, rea

Details for d5fhzc_

PDB Entry: 5fhz (more details), 2.9 Å

PDB Description: human aldehyde dehydrogenase 1a3 complexed with nad(+) and retinoic acid
PDB Compounds: (C:) Aldehyde dehydrogenase family 1 member A3

SCOPe Domain Sequences for d5fhzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fhzc_ c.82.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lprpirnlevkftkifinnewhesksgkkfatcnpstreqiceveegdkpdvdkaveaaq
vafqrgspwrrldalsrgrllhqladlverdratlaaletmdtgkpflhaffidlegcir
tlryfagwadkiqgktiptddnvvcftrhepigvcgaitpwnfpllmlvwklapalccgn
tmvlkpaeqtpltalylgslikeagfppgvvnivpgfgptvgaaisshpqinkiaftgst
evgklvkeaasrsnlkrvtlelggknpcivcadadldlavecahqgvffnqgqcctaasr
vfveeqvysefvrrsveyakkrpvgdpfdvkteqgpqidqkqfdkileliesgkkegakl
ecggsamedkglfikptvfsevtdnmriakeeifgpvqpilkfksieevikranstdygl
taavftknldkalklasalesgtvwincynalyaqapfggfkmsgngrelgeyalaeyte
vktvtiklg

SCOPe Domain Coordinates for d5fhzc_:

Click to download the PDB-style file with coordinates for d5fhzc_.
(The format of our PDB-style files is described here.)

Timeline for d5fhzc_: