SCOP 1.67: Domain d1a1va2: 1a1v A:326-624

Lineage for d1a1va2 (1a1v A:326-624)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (1 protein)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein HCV helicase domain [52725] (1 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (6 PDB entries)

8. Domain d1a1va2: 1a1v A:326-624 [32468]
   protein/DNA complex; complexed with so4; mutant

Details for d1a1va2

PDB Entry: 1a1v, 2.2 Å

PDB Description: hepatitis c virus ns3 helicase domain complexed with single stranded sdna

SCOP Domain Sequences for d1a1va2:

Sequence, based on SEQRES records:

>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates}
pgsvtvphpnieevalsttgeipfygkaiplevikggrhlifchskkkcdelaaklvalg
inavayyrgldvsviptsgdvvvvatdalmtgftgdfdsvidcntcvtqtvdfsldptft
ietttlpqdavsrtqrrgrtgrgkpgiyrfvapgerpsgmfdssvlcecydagcawyelt
paettvrlraymntpglpvcqdhlefwegvftglthidahflsqtkqsgenfpylvayqa
tvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevtlthpitkyimtcms

Sequence, based on observed residues (ATOM records):

>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates}
pgsvtvphpnieevalsttgeipfygkaiplevikggrhlifchskkkcdelaaklvalg
inavayyrgldvsviptsgdvvvvatdalftgdfdsvidcntcvtqtvdfsldptftiet
ttlpqdavsrtqrrgrtgrgkpgiyrfvapgerpsgmfdssvlcecydagcawyeltpae
ttvrlraymntpglpvcqdhlefwegvftglthidahflsqtkqsgenfpylvayqatvc
araqapppswdqmwkclirlkptlhgptpllyrlgavqnevtlthpitkyimtcms

Timeline for d1a1va2:

• d1a1va2 first appeared (with stable ids) in SCOP 1.55
  
• d1a1va2 appears in SCOP 1.65
  
• d1a1va2 appears in SCOP 1.69
  
• d1a1va2 appears in the current release, SCOPe 2.08