Lineage for d1a1va2 (1a1v A:326-624)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870435Family c.37.1.14: RNA helicase [52724] (7 proteins)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 2870448Protein HCV helicase domain, C-terminal domain [418963] (1 species)
  7. 2870449Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [419425] (15 PDB entries)
  8. 2870450Domain d1a1va2: 1a1v A:326-624 [32468]
    Other proteins in same PDB: d1a1va1
    protein/DNA complex; protein/RNA complex; complexed with so4
    has additional subdomain(s) that are not in the common domain

Details for d1a1va2

PDB Entry: 1a1v (more details), 2.2 Å

PDB Description: hepatitis c virus ns3 helicase domain complexed with single stranded sdna
PDB Compounds: (A:) protein (ns3 protein)

SCOPe Domain Sequences for d1a1va2:

Sequence, based on SEQRES records: (download)

>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain, C-terminal domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
pgsvtvphpnieevalsttgeipfygkaiplevikggrhlifchskkkcdelaaklvalg
inavayyrgldvsviptsgdvvvvatdalmtgftgdfdsvidcntcvtqtvdfsldptft
ietttlpqdavsrtqrrgrtgrgkpgiyrfvapgerpsgmfdssvlcecydagcawyelt
paettvrlraymntpglpvcqdhlefwegvftglthidahflsqtkqsgenfpylvayqa
tvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevtlthpitkyimtcms

Sequence, based on observed residues (ATOM records): (download)

>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain, C-terminal domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
pgsvtvphpnieevalsttgeipfygkaiplevikggrhlifchskkkcdelaaklvalg
inavayyrgldvsviptsgdvvvvatdalftgdfdsvidcntcvtqtvdfsldptftiet
ttlpqdavsrtqrrgrtgrgkpgiyrfvapgerpsgmfdssvlcecydagcawyeltpae
ttvrlraymntpglpvcqdhlefwegvftglthidahflsqtkqsgenfpylvayqatvc
araqapppswdqmwkclirlkptlhgptpllyrlgavqnevtlthpitkyimtcms

SCOPe Domain Coordinates for d1a1va2:

Click to download the PDB-style file with coordinates for d1a1va2.
(The format of our PDB-style files is described here.)

Timeline for d1a1va2: