Lineage for d5hhta3 (5hht A:528-663)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880614Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2880615Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2880787Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. 2880788Protein automated matches [226991] (9 species)
    not a true protein
  7. 2880809Species Escherichia coli [TaxId:83333] [324642] (4 PDB entries)
  8. 2880816Domain d5hhta3: 5hht A:528-663 [324670]
    Other proteins in same PDB: d5hhta1, d5hhta2, d5hhtb1, d5hhtb2, d5hhtb4
    automated match to d2r8oa3
    complexed with ca, edo, tdp

Details for d5hhta3

PDB Entry: 5hht (more details), 1.5 Å

PDB Description: crystal structure of e. coli transketolase triple variant ser385tyr/asp469thr/arg520gln
PDB Compounds: (A:) Transketolase 1

SCOPe Domain Sequences for d5hhta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hhta3 c.48.1.0 (A:528-663) automated matches {Escherichia coli [TaxId: 83333]}
rteeqlaniarggyvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstd
afdkqdaayresvlpkavtarvaveagiadywykyvglngaivgmttfgesapaellfee
fgftvdnvvakakell

SCOPe Domain Coordinates for d5hhta3:

Click to download the PDB-style file with coordinates for d5hhta3.
(The format of our PDB-style files is described here.)

Timeline for d5hhta3: