![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) ![]() |
![]() | Family c.37.1.14: RNA helicase [52724] (1 protein) |
![]() | Protein HCV helicase domain [52725] (1 species) |
![]() | Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (4 PDB entries) |
![]() | Domain d1a1va1: 1a1v A:190-325 [32467] |
PDB Entry: 1a1v (more details), 2.2 Å
SCOP Domain Sequences for d1a1va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates} ppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgvd pnirtgvrtittgspitystygkfladggcsggaydiiicdechstdatsilgigtvldq aetagarlvvlatatp
Timeline for d1a1va1: