Lineage for d5kncf1 (5knc F:1-75)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067173Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 2067174Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2067393Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2067394Protein automated matches [254527] (11 species)
    not a true protein
  7. 2067470Species Enterococcus hirae [TaxId:768486] [324658] (2 PDB entries)
  8. 2067476Domain d5kncf1: 5knc F:1-75 [324659]
    Other proteins in same PDB: d5kncd2, d5kncd3, d5knce2, d5knce3, d5kncf2, d5kncf3, d5kncg_
    automated match to d3vr2d1
    complexed with adp, gol, mg, so4

Details for d5kncf1

PDB Entry: 5knc (more details), 3.02 Å

PDB Description: crystal structure of the 3 adp-bound v1 complex
PDB Compounds: (F:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d5kncf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kncf1 b.49.1.0 (F:1-75) automated matches {Enterococcus hirae [TaxId: 768486]}
mikeyrtikevvgplmavekvsgvkyeelievrmqngeirrgqvlevqedkamvqifegt
sginlknssvrflgh

SCOPe Domain Coordinates for d5kncf1:

Click to download the PDB-style file with coordinates for d5kncf1.
(The format of our PDB-style files is described here.)

Timeline for d5kncf1: