Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (61 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225691] (37 PDB entries) |
Domain d5fhzd_: 5fhz D: [324657] automated match to d3u4jb_ complexed with nad, rea |
PDB Entry: 5fhz (more details), 2.9 Å
SCOPe Domain Sequences for d5fhzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fhzd_ c.82.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lprpirnlevkftkifinnewhesksgkkfatcnpstreqiceveegdkpdvdkaveaaq vafqrgspwrrldalsrgrllhqladlverdratlaaletmdtgkpflhaffidlegcir tlryfagwadkiqgktiptddnvvcftrhepigvcgaitpwnfpllmlvwklapalccgn tmvlkpaeqtpltalylgslikeagfppgvvnivpgfgptvgaaisshpqinkiaftgst evgklvkeaasrsnlkrvtlelggknpcivcadadldlavecahqgvffnqgqcctaasr vfveeqvysefvrrsveyakkrpvgdpfdvkteqgpqidqkqfdkileliesgkkegakl ecggsamedkglfikptvfsevtdnmriakeeifgpvqpilkfksieevikranstdygl taavftknldkalklasalesgtvwincynalyaqapfggfkmsgngrelgeyalaeyte vktvtikl
Timeline for d5fhzd_: