Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
Protein automated matches [191197] (9 species) not a true protein |
Species Clostridium perfringens [TaxId:1502] [324645] (5 PDB entries) |
Domain d5h03a1: 5h03 A:3-210 [324655] automated match to d1giqa1 |
PDB Entry: 5h03 (more details), 1.89 Å
SCOPe Domain Sequences for d5h03a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h03a1 d.166.1.0 (A:3-210) automated matches {Clostridium perfringens [TaxId: 1502]} ddnrpmdfakdknsatlwakkrkqvwlnnlskaestsinnyiknsseinsysikkkfald nyegietlnedlknistavkksmltkplyvyyyeandkfgfnqnlessldsniideeain nfakkisdtnfiqdgfkdvtmtepdinsklpilvhlklptntpaasygndeenlrvlidq gyslkatglsivtikgkqyakvdadlik
Timeline for d5h03a1: