Lineage for d5h03a1 (5h03 A:3-210)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234147Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2234148Protein automated matches [191197] (9 species)
    not a true protein
  7. 2234180Species Clostridium perfringens [TaxId:1502] [324645] (5 PDB entries)
  8. 2234185Domain d5h03a1: 5h03 A:3-210 [324655]
    automated match to d1giqa1

Details for d5h03a1

PDB Entry: 5h03 (more details), 1.89 Å

PDB Description: crystal structure of an adp-ribosylating toxin beca from c. perfringens
PDB Compounds: (A:) Binary enterotoxin of Clostridium perfringens component a

SCOPe Domain Sequences for d5h03a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h03a1 d.166.1.0 (A:3-210) automated matches {Clostridium perfringens [TaxId: 1502]}
ddnrpmdfakdknsatlwakkrkqvwlnnlskaestsinnyiknsseinsysikkkfald
nyegietlnedlknistavkksmltkplyvyyyeandkfgfnqnlessldsniideeain
nfakkisdtnfiqdgfkdvtmtepdinsklpilvhlklptntpaasygndeenlrvlidq
gyslkatglsivtikgkqyakvdadlik

SCOPe Domain Coordinates for d5h03a1:

Click to download the PDB-style file with coordinates for d5h03a1.
(The format of our PDB-style files is described here.)

Timeline for d5h03a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5h03a2