![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.14: RNA helicase [52724] (1 protein) duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension |
![]() | Protein HCV helicase domain [52725] (1 species) |
![]() | Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (6 PDB entries) |
![]() | Domain d1heib1: 1hei B:188-325 [32465] |
PDB Entry: 1hei (more details), 2.1 Å
SCOP Domain Sequences for d1heib1:
Sequence, based on SEQRES records: (download)
>d1heib1 c.37.1.14 (B:188-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates} ssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahg vdpnirtgvrtittgspitystygkfladggcsggaydiiicdechstdatsilgigtvl dqaetagarlvvlatatp
>d1heib1 c.37.1.14 (B:188-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates} ssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvgspitystygkflad ggcsggaydiiicdechstdatsilgigtvldqaetagarlvvlatatp
Timeline for d1heib1: