Lineage for d1heib1 (1hei B:188-325)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 314437Family c.37.1.14: RNA helicase [52724] (1 protein)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 314438Protein HCV helicase domain [52725] (1 species)
  7. 314439Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (6 PDB entries)
  8. 314444Domain d1heib1: 1hei B:188-325 [32465]

Details for d1heib1

PDB Entry: 1hei (more details), 2.1 Å

PDB Description: structure of the hepatitis c virus rna helicase domain

SCOP Domain Sequences for d1heib1:

Sequence, based on SEQRES records: (download)

>d1heib1 c.37.1.14 (B:188-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates}
ssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahg
vdpnirtgvrtittgspitystygkfladggcsggaydiiicdechstdatsilgigtvl
dqaetagarlvvlatatp

Sequence, based on observed residues (ATOM records): (download)

>d1heib1 c.37.1.14 (B:188-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates}
ssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvgspitystygkflad
ggcsggaydiiicdechstdatsilgigtvldqaetagarlvvlatatp

SCOP Domain Coordinates for d1heib1:

Click to download the PDB-style file with coordinates for d1heib1.
(The format of our PDB-style files is described here.)

Timeline for d1heib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1heib2