SCOP 1.63: Domain d1heib1: 1hei B:188-325

Lineage for d1heib1 (1hei B:188-325)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (1 protein)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein HCV helicase domain [52725] (1 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (5 PDB entries)

8. Domain d1heib1: 1hei B:188-325 [32465]

Details for d1heib1

PDB Entry: 1hei, 2.1 Å

PDB Description: structure of the hepatitis c virus rna helicase domain

SCOP Domain Sequences for d1heib1:

Sequence, based on SEQRES records:

>d1heib1 c.37.1.14 (B:188-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates}
ssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahg
vdpnirtgvrtittgspitystygkfladggcsggaydiiicdechstdatsilgigtvl
dqaetagarlvvlatatp

Sequence, based on observed residues (ATOM records):

>d1heib1 c.37.1.14 (B:188-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates}
ssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvgspitystygkflad
ggcsggaydiiicdechstdatsilgigtvldqaetagarlvvlatatp

Timeline for d1heib1:

• d1heib1 first appeared (with stable ids) in SCOP 1.55
  
• d1heib1 appears in SCOP 1.61
  
• d1heib1 appears in SCOP 1.65
  
• d1heib1 appears in the current release, SCOPe 2.08