![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
![]() | Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
![]() | Protein automated matches [191197] (13 species) not a true protein |
![]() | Species Clostridium perfringens [TaxId:1502] [324645] (5 PDB entries) |
![]() | Domain d5h04a2: 5h04 A:211-419 [324647] automated match to d1giqa2 complexed with nai |
PDB Entry: 5h04 (more details), 1.83 Å
SCOPe Domain Sequences for d5h04a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h04a2 d.166.1.0 (A:211-419) automated matches {Clostridium perfringens [TaxId: 1502]} qlnfendvisasqwgeenyapwlkeltsnelrdinnylgggytainkylldgtigentsk edleekisnissalkkrkipediityrrmgpnefgldlnspdydfnkvenvskfkekwlg ktipvktfisttvlsnnisafakrklilrlhlpngsnaayvsvaegykneyevlidhgys ykidniteyydesslggktnkliidatli
Timeline for d5h04a2: