SCOPe 2.08: Domain d5h04a1: 5h04 A:1-210

Lineage for d5h04a1 (5h04 A:1-210)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (13 species)
   not a true protein

7. Species Clostridium perfringens [TaxId:1502] [324645] (5 PDB entries)

8. Domain d5h04a1: 5h04 A:1-210 [324646]
   automated match to d1giqa1
   complexed with nai

Details for d5h04a1

PDB Entry: 5h04, 1.83 Å

PDB Description: crystal structure of an adp-ribosylating toxin beca of a novel binary enterotoxin of c. perfringens with nadh

PDB Compounds: (A:) Binary enterotoxin of Clostridium perfringens component a

SCOPe Domain Sequences for d5h04a1:

Sequence; same for both SEQRES and ATOM records:

>d5h04a1 d.166.1.0 (A:1-210) automated matches {Clostridium perfringens [TaxId: 1502]}
mlddnrpmdfakdknsatlwakkrkqvwlnnlskaestsinnyiknsseinsysikkkfa
ldnyegietlnedlknistavkksmltkplyvyyyeandkfgfnqnlessldsniideea
innfakkisdtnfiqdgfkdvtmtepdinsklpilvhlklptntpaasygndeenlrvli
dqgyslkatglsivtikgkqyakvdadlik

Timeline for d5h04a1:

• d5h04a1 first appeared in SCOPe 2.06
  
• d5h04a1 appears in SCOPe 2.07