Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (20 species) not a true protein |
Species Escherichia coli [TaxId:83333] [324640] (1 PDB entry) |
Domain d5hhtb2: 5hht B:333-527 [324641] Other proteins in same PDB: d5hhta1, d5hhta3, d5hhtb1, d5hhtb3, d5hhtb4 automated match to d1qgda1 complexed with ca, edo, tdp |
PDB Entry: 5hht (more details), 1.5 Å
SCOPe Domain Sequences for d5hhtb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hhtb2 c.36.1.0 (B:333-527) automated matches {Escherichia coli [TaxId: 83333]} mpsdfdakakefiaklqanpakiasrkasqnaieafgpllpeflggsadlapynltlwsg skainedaagnyihygvrefgmtaiangislhggflpytstflmfveyarnavrmaalmk qrqvmvythdsiglgetgpthqpveqvaslrvtpnmstwrpcdqvesavawkygverqdg ptalilsqqnlaqqe
Timeline for d5hhtb2: