Lineage for d1heia2 (1hei A:326-629)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122721Family c.37.1.14: RNA helicase [52724] (1 protein)
  6. 122722Protein HCV helicase domain [52725] (1 species)
  7. 122723Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (4 PDB entries)
  8. 122727Domain d1heia2: 1hei A:326-629 [32464]

Details for d1heia2

PDB Entry: 1hei (more details), 2.1 Å

PDB Description: structure of the hepatitis c virus rna helicase domain

SCOP Domain Sequences for d1heia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1heia2 c.37.1.14 (A:326-629) HCV helicase domain {Human hepatitis C virus (HCV), different isolates}
pgsvtvshpnieevalsttgeipfygkaiplevikggrhlifchskkkcdelaaklvalg
inavayyrgldvsviptngdvvvvstdalmtgftgdfdsvidcntcvtqtvdfsldptft
ietttlpqdavsrtqrrgrtgrgkpgiyrfvapgerpsgmfdssvlcecydagcawyelm
paettvrlraymntpglpvcqdhlefwegvftglthidahflsqtkqsgenfpylvayqa
tvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevtlthpitkyimtcmsa
dlev

SCOP Domain Coordinates for d1heia2:

Click to download the PDB-style file with coordinates for d1heia2.
(The format of our PDB-style files is described here.)

Timeline for d1heia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1heia1