Lineage for d5hhtb1 (5hht B:2-332)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122269Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2122270Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2122701Family c.36.1.10: TK-like PP module [88760] (3 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 2122752Protein automated matches [254698] (2 species)
    not a true protein
  7. 2122753Species Escherichia coli [TaxId:83333] [324638] (1 PDB entry)
  8. 2122755Domain d5hhtb1: 5hht B:2-332 [324639]
    Other proteins in same PDB: d5hhta2, d5hhta3, d5hhtb2, d5hhtb3, d5hhtb4
    automated match to d1qgda2
    complexed with ca, edo, tdp

Details for d5hhtb1

PDB Entry: 5hht (more details), 1.5 Å

PDB Description: crystal structure of e. coli transketolase triple variant ser385tyr/asp469thr/arg520gln
PDB Compounds: (B:) Transketolase 1

SCOPe Domain Sequences for d5hhtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hhtb1 c.36.1.10 (B:2-332) automated matches {Escherichia coli [TaxId: 83333]}
ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgia
navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
akesawnekfaayakaypqeaaeftrrmkge

SCOPe Domain Coordinates for d5hhtb1:

Click to download the PDB-style file with coordinates for d5hhtb1.
(The format of our PDB-style files is described here.)

Timeline for d5hhtb1: