SCOP 1.59: Domain d1heia1: 1hei A:187-325

Lineage for d1heia1 (1hei A:187-325)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families)

5. Family c.37.1.14: RNA helicase [52724] (1 protein)

6. Protein HCV helicase domain [52725] (1 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (4 PDB entries)

8. Domain d1heia1: 1hei A:187-325 [32463]

Details for d1heia1

PDB Entry: 1hei, 2.1 Å

PDB Description: structure of the hepatitis c virus rna helicase domain

SCOP Domain Sequences for d1heia1:

Sequence; same for both SEQRES and ATOM records:

>d1heia1 c.37.1.14 (A:187-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates}
nssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskah
gvdpnirtgvrtittgspitystygkfladggcsggaydiiicdechstdatsilgigtv
ldqaetagarlvvlatatp

Timeline for d1heia1:

• d1heia1 first appeared (with stable ids) in SCOP 1.55
  
• d1heia1 appears in SCOP 1.57
  
• d1heia1 appears in SCOP 1.61
  
• d1heia1 appears in the current release, SCOPe 2.08