Lineage for d5loqd_ (5loq D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2193227Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2193599Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2193600Protein automated matches [190081] (27 species)
    not a true protein
  7. 2193707Species Listeria monocytogenes [TaxId:1639] [324509] (1 PDB entry)
  8. 2193711Domain d5loqd_: 5loq D: [324577]
    automated match to d1vdha_
    complexed with fec, mpd, na

Details for d5loqd_

PDB Entry: 5loq (more details), 1.69 Å

PDB Description: structure of coproheme bound hemq from listeria monocytogenes
PDB Compounds: (D:) Putative heme-dependent peroxidase lmo2113

SCOPe Domain Sequences for d5loqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5loqd_ d.58.4.0 (D:) automated matches {Listeria monocytogenes [TaxId: 1639]}
neavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiy
silgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmagg
ddpyqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsy
agkvqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlll
seqlsklfti

SCOPe Domain Coordinates for d5loqd_:

Click to download the PDB-style file with coordinates for d5loqd_.
(The format of our PDB-style files is described here.)

Timeline for d5loqd_: