SCOPe 2.08: Domain d5t3ub1: 5t3u B:5-136

Lineage for d5t3ub1 (5t3u B:5-136)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families)
   active dimer is formed by strand 5 swapping

5. Family c.54.1.0: automated matches [191356] (1 protein)
   not a true family

6. Protein automated matches [190395] (8 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [324554] (1 PDB entry)

8. Domain d5t3ub1: 5t3u B:5-136 [324560]
   Other proteins in same PDB: d5t3ua2, d5t3ub2
   automated match to d3lfhc_
   complexed with 15p

Details for d5t3ub1

PDB Entry: 5t3u, 2.15 Å

PDB Description: crystal structure of the pts iia protein associated with the fucose utilization operon from streptococcus pneumoniae

PDB Compounds: (B:) PTS system, IIA component

SCOPe Domain Sequences for d5t3ub1:

Sequence; same for both SEQRES and ATOM records:

>d5t3ub1 c.54.1.0 (B:5-136) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
fnrgilvashgnfasgalmtaemfvgettndrvrtlglmpgenivefehyfknqvdelld
snqevivltdliggspnnvalsrflnldsvdivtgfnipllvelissydskinleeivhn
aqnslfnvkqql

Timeline for d5t3ub1:

• d5t3ub1 first appeared in SCOPe 2.06
  
• d5t3ub1 appears in SCOPe 2.07