Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) active dimer is formed by strand 5 swapping |
Family c.54.1.0: automated matches [191356] (1 protein) not a true family |
Protein automated matches [190395] (8 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:170187] [324554] (1 PDB entry) |
Domain d5t3ub1: 5t3u B:5-136 [324560] Other proteins in same PDB: d5t3ua2, d5t3ub2 automated match to d3lfhc_ complexed with 15p |
PDB Entry: 5t3u (more details), 2.15 Å
SCOPe Domain Sequences for d5t3ub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t3ub1 c.54.1.0 (B:5-136) automated matches {Streptococcus pneumoniae [TaxId: 170187]} fnrgilvashgnfasgalmtaemfvgettndrvrtlglmpgenivefehyfknqvdelld snqevivltdliggspnnvalsrflnldsvdivtgfnipllvelissydskinleeivhn aqnslfnvkqql
Timeline for d5t3ub1: