SCOPe 2.08: Domain d5t5da_: 5t5d A:

Lineage for d5t5da_ (5t5d A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.38: PTS IIb component [52727] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 6 strands, order 324156

4. Superfamily c.38.1: PTS IIb component [52728] (2 families)

5. Family c.38.1.0: automated matches [191563] (1 protein)
   not a true family

6. Protein automated matches [190977] (5 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [324546] (1 PDB entry)

8. Domain d5t5da_: 5t5d A: [324547]
   automated match to d1nrza_

Details for d5t5da_

PDB Entry: 5t5d, 2.5 Å

PDB Description: crystal structure of the pts iib protein associated with the fucose utilization operon from streptococcus pneumoniae

PDB Compounds: (A:) PTS system, IIB component

SCOPe Domain Sequences for d5t5da_:

Sequence, based on SEQRES records:

>d5t5da_ c.38.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
siefvriddrlvhgqvvttwlkkydieqviivndrisedktrqsilkisapvglkivffs
vkrfvevlnsvpikkrtmliytnpkdvydsiegnlkleylnvgqmskteenekvtggval
geedkyyfkkivdkgtrveiqmvpndkvtmlekfl

Sequence, based on observed residues (ATOM records):

>d5t5da_ c.38.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
siefvriddrlvhgqvvttwlkkydieqviivndrisedktrqsilkisapvglkivffs
vkrfvevlnsvpikkrtmliytnpkdvydsiegnlkleylnvgqmsekvtggvalgeedk
yyfkkivdkgtrveiqmvpndkvtmlekfl

Timeline for d5t5da_:

• d5t5da_ first appeared in SCOPe 2.06
  
• d5t5da_ appears in SCOPe 2.07