Lineage for d1g4bk_ (1g4b K:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 70260Family c.37.1.13: Extended AAA-ATPase domain [52700] (15 proteins)
  6. 70318Protein HslU [52721] (2 species)
  7. 70319Species Escherichia coli [TaxId:562] [52722] (5 PDB entries)
  8. 70336Domain d1g4bk_: 1g4b K: [32448]
    Other proteins in same PDB: d1g4bm_, d1g4bn_, d1g4bo_, d1g4bp_

Details for d1g4bk_

PDB Entry: 1g4b (more details), 7 Å

PDB Description: crystal structures of the hslvu peptidase-atpase complex reveal an atp-dependent proteolysis mechanism

SCOP Domain Sequences for d1g4bk_:

Sequence, based on SEQRES records: (download)

>d1g4bk_ c.37.1.13 (K:) HslU {Escherichia coli}
semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaap
mgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkq
daidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktdh
ilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmat
egvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitid
adyvskhldalvadedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d1g4bk_ c.37.1.13 (K:) HslU {Escherichia coli}
semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
raeelaeerildvlippaknnwgqteqqqepsaarqafrkklreglkikdamkllieeea
aklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctv
stkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnas
itvqykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisyda
sdlsgqnitidadyvskhldalvadedlsrfil

SCOP Domain Coordinates for d1g4bk_:

Click to download the PDB-style file with coordinates for d1g4bk_.
(The format of our PDB-style files is described here.)

Timeline for d1g4bk_: