Class g: Small proteins [56992] (100 folds) |
Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily) |
Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex |
Family g.96.1.0: automated matches [324385] (1 protein) not a true family |
Protein automated matches [324386] (3 species) not a true protein |
Species Zika virus (strain mr 766) [TaxId:64320] [324387] (1 PDB entry) |
Domain d5gj4c1: 5gj4 C:49-87 [324472] Other proteins in same PDB: d5gj4b_, d5gj4d_, d5gj4f_, d5gj4h_ automated match to d2ijoa_ complexed with cl |
PDB Entry: 5gj4 (more details), 1.84 Å
SCOPe Domain Sequences for d5gj4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gj4c1 g.96.1.0 (C:49-87) automated matches {Zika virus (strain mr 766) [TaxId: 64320]} vdmyieragditwekdaevtgnsprldvaldesgdfslv
Timeline for d5gj4c1: