Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries) |
Domain d5b8cg_: 5b8c G: [324462] Other proteins in same PDB: d5b8cc1, d5b8cc2, d5b8cf1, d5b8cf2, d5b8ci1, d5b8ci2, d5b8cl1, d5b8cl2 automated match to d1rvfl_ |
PDB Entry: 5b8c (more details), 2.15 Å
SCOPe Domain Sequences for d5b8cg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b8cg_ b.1.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivltqspatlslspgeratlscraskgvstsgysylhwyqqkpgqaprlliylasyles gvparfsgsgsgtdftltisslepedfavyycqhsrdlpltfgggtkveik
Timeline for d5b8cg_: