Lineage for d1g4ae_ (1g4a E:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23655Family c.37.1.13: Extended AAA-ATPase domain [52700] (10 proteins)
  6. 23692Protein HslU [52721] (2 species)
  7. 23693Species Escherichia coli [TaxId:562] [52722] (5 PDB entries)
  8. 23702Domain d1g4ae_: 1g4a E: [32444]
    Other proteins in same PDB: d1g4aa_, d1g4ab_, d1g4ac_, d1g4ad_

Details for d1g4ae_

PDB Entry: 1g4a (more details), 3 Å

PDB Description: crystal structures of the hslvu peptidase-atpase complex reveal an atp-dependent proteolysis mechanism

SCOP Domain Sequences for d1g4ae_:

Sequence, based on SEQRES records: (download)

>d1g4ae_ c.37.1.13 (E:) HslU {Escherichia coli}
msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
dadyvskhldalvadedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d1g4ae_ c.37.1.13 (E:) HslU {Escherichia coli}
msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
yraeelaeerildamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrges
sgpdvsregvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlp
irvelqalttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnest
enigarrlhtvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil

SCOP Domain Coordinates for d1g4ae_:

Click to download the PDB-style file with coordinates for d1g4ae_.
(The format of our PDB-style files is described here.)

Timeline for d1g4ae_: