Lineage for d5b8cl1 (5b8c L:32-146)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023700Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)
  7. 2023706Species Mouse (Mus musculus) [TaxId:10090] [101511] (6 PDB entries)
  8. 2023715Domain d5b8cl1: 5b8c L:32-146 [324422]
    Other proteins in same PDB: d5b8ca_, d5b8cb_, d5b8cc2, d5b8cd_, d5b8ce_, d5b8cf2, d5b8cg_, d5b8ch_, d5b8ci2, d5b8cj_, d5b8ck_, d5b8cl2
    automated match to d3bikc_

Details for d5b8cl1

PDB Entry: 5b8c (more details), 2.15 Å

PDB Description: high resolution structure of the human pd-1 in complex with pembrolizumab fv
PDB Compounds: (L:) Programmed cell death protein 1

SCOPe Domain Sequences for d5b8cl1:

Sequence, based on SEQRES records: (download)

>d5b8cl1 b.1.1.1 (L:32-146) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]}
wnpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgq
dsrfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvte

Sequence, based on observed residues (ATOM records): (download)

>d5b8cl1 b.1.1.1 (L:32-146) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]}
wnpptfspallvvtegdnatftcsfsnsfvlnwyrmspsnqtdklaafpedrsqpgqdsr
frvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvte

SCOPe Domain Coordinates for d5b8cl1:

Click to download the PDB-style file with coordinates for d5b8cl1.
(The format of our PDB-style files is described here.)

Timeline for d5b8cl1: