Lineage for d5ekxb1 (5ekx B:7-256)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146607Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2146608Protein automated matches [190689] (64 species)
    not a true protein
  7. 2146669Species Dengue virus type 3 (strain philippines/h87/1956) [TaxId:408870] [324373] (4 PDB entries)
  8. 2146675Domain d5ekxb1: 5ekx B:7-256 [324409]
    Other proteins in same PDB: d5ekxa2, d5ekxb2
    automated match to d3elda_
    complexed with 2cq, sam

Details for d5ekxb1

PDB Entry: 5ekx (more details), 1.76 Å

PDB Description: dengue 3 ns5 methyltransferase bound to s-adenosylmethionine and fragment nb2e11
PDB Compounds: (B:) NS5 methyltransferase

SCOPe Domain Sequences for d5ekxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ekxb1 c.66.1.0 (B:7-256) automated matches {Dengue virus type 3 (strain philippines/h87/1956) [TaxId: 408870]}
etlgekwkkklnqlsrkefdlykksgitevdrteakeglkrgetthhavsrgsaklqwfv
ernmvipegrvidlgcgrggwsyycaglkkvtevrgytkggpgheepvpmstygwnivkl
msgkdvfylppekcdtllcdigesspsptveesrtirvlkmvepwlknnqfcikvlnpym
ptviehlerlqrkhggmlvrnplsrnsthemywisngtgnivssvnmvsrlllnrftmth
rrptiekdvd

SCOPe Domain Coordinates for d5ekxb1:

Click to download the PDB-style file with coordinates for d5ekxb1.
(The format of our PDB-style files is described here.)

Timeline for d5ekxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ekxb2