Lineage for d5gj4b_ (5gj4 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797067Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2797157Protein automated matches [190658] (12 species)
    not a true protein
  7. 2797271Species Zika virus (strain mr 766) [TaxId:64320] [324405] (8 PDB entries)
  8. 2797276Domain d5gj4b_: 5gj4 B: [324406]
    Other proteins in same PDB: d5gj4a1, d5gj4c1, d5gj4e1, d5gj4g1
    automated match to d3e90d_
    complexed with cl

Details for d5gj4b_

PDB Entry: 5gj4 (more details), 1.84 Å

PDB Description: structure of ns2b-ns3 protease from zika virus caught after self- cleavage
PDB Compounds: (B:) Serine protease NS3

SCOPe Domain Sequences for d5gj4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gj4b_ b.47.1.3 (B:) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
tdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdlvs
ycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsgsp
ildkcgrviglygngvvikngsyvsaitqgkre

SCOPe Domain Coordinates for d5gj4b_:

Click to download the PDB-style file with coordinates for d5gj4b_.
(The format of our PDB-style files is described here.)

Timeline for d5gj4b_: