SCOPe 2.08: Domain d5ehic1: 5ehi C:7-256

Lineage for d5ehic1 (5ehi C:7-256)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (87 species)
   not a true protein

7. Species Dengue virus type 3 (strain philippines/h87/1956) [TaxId:408870] [324373] (4 PDB entries)

8. Domain d5ehic1: 5ehi C:7-256 [324379]
   Other proteins in same PDB: d5ehia2, d5ehic2
   automated match to d3elda_
   complexed with 5o3, sam

Details for d5ehic1

PDB Entry: 5ehi, 1.3 Å

PDB Description: dengue 3 ns5 methyltransferase bound to s-adenosyl methionine and molecule bf287

PDB Compounds: (C:) NS5 methyltransferase dengue virus

SCOPe Domain Sequences for d5ehic1:

Sequence; same for both SEQRES and ATOM records:

>d5ehic1 c.66.1.0 (C:7-256) automated matches {Dengue virus type 3 (strain philippines/h87/1956) [TaxId: 408870]}
etlgekwkkklnqlsrkefdlykksgitevdrteakeglkrgetthhavsrgsaklqwfv
ernmvipegrvidlgcgrggwsyycaglkkvtevrgytkggpgheepvpmstygwnivkl
msgkdvfylppekcdtllcdigesspsptveesrtirvlkmvepwlknnqfcikvlnpym
ptviehlerlqrkhggmlvrnplsrnsthemywisngtgnivssvnmvsrlllnrftmth
rrptiekdvd

Timeline for d5ehic1:

• d5ehic1 first appeared in SCOPe 2.06
  
• d5ehic1 appears in SCOPe 2.07