SCOPe 2.08: Domain d5bt1d_: 5bt1 D:

Lineage for d5bt1d_ (5bt1 D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256335] (7 PDB entries)

8. Domain d5bt1d_: 5bt1 D: [324358]
   automated match to d1s32d_

Details for d5bt1d_

PDB Entry: 5bt1, 2.62 Å

PDB Description: histone chaperone hif1 playing with histone h2a-h2b dimer

PDB Compounds: (D:) Histone H2B.1

SCOPe Domain Sequences for d5bt1d_:

Sequence; same for both SEQRES and ATOM records:

>d5bt1d_ a.22.1.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisare
iqtavrlilpgelakhavsegtravtkyss

Timeline for d5bt1d_:

• d5bt1d_ first appeared in SCOPe 2.06
  
• d5bt1d_ appears in SCOPe 2.07