Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold |
Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families) |
Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (2 proteins) |
Protein automated matches [254631] (2 species) not a true protein |
Species Streptomyces sp. [TaxId:1400207] [321772] (2 PDB entries) |
Domain d5b6ia1: 5b6i A:8-192 [324355] Other proteins in same PDB: d5b6ia2, d5b6ib2 automated match to d1rqpa2 complexed with adn, met |
PDB Entry: 5b6i (more details), 1.95 Å
SCOPe Domain Sequences for d5b6ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b6ia1 c.132.1.1 (A:8-192) automated matches {Streptomyces sp. [TaxId: 1400207]} rpiiafmsdlgttddsvaqckglmhsicpgvtvvdvchsmtpwdveegaryivdlprffp egtvfatttypatgtttrsvavrirqaakggargqwagsgdgferadgsyiyiapnngll ttvleehgyieayevtstkvipanpeptfysremvaipsahlaagfplaevgrrlddsei vrfhr
Timeline for d5b6ia1: