Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Factor D [50563] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50564] (29 PDB entries) |
Domain d5tcad_: 5tca D: [324300] automated match to d1bioa_ complexed with j55 |
PDB Entry: 5tca (more details), 3.15 Å
SCOPe Domain Sequences for d5tcad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tcad_ b.47.1.2 (D:) Factor D {Human (Homo sapiens) [TaxId: 9606]} ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
Timeline for d5tcad_: