Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) |
Family c.37.1.13: Extended AAA-ATPase domain [52700] (16 proteins) |
Protein Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein [52717] (1 species) |
Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [52718] (2 PDB entries) |
Domain d1nsf__: 1nsf - [32429] |
PDB Entry: 1nsf (more details), 1.9 Å
SCOP Domain Sequences for d1nsf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nsf__ c.37.1.13 (-) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus)} kpafgtnqedyasyimngiikwgdpvtrvlddgellvqqtknsdrtplvsvllegpphsg ktalaakiaeesnfpfikicspdkmigfsetakcqamkkifddayksqlscvvvddierl ldyvpigprfsnlvlqallvllkkappqgrklliigttsrkdvlqememlnafsttihvp niatgeqllealellgnfkdkerttiaqqvkgkkvwigikkllmliemslqmdpeyrvrk flallre
Timeline for d1nsf__: