Lineage for d1d2na_ (1d2n A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 180169Family c.37.1.13: Extended AAA-ATPase domain [52700] (17 proteins)
  6. 180217Protein Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein [52717] (1 species)
  7. 180218Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [52718] (2 PDB entries)
  8. 180219Domain d1d2na_: 1d2n A: [32428]

Details for d1d2na_

PDB Entry: 1d2n (more details), 1.75 Å

PDB Description: d2 domain of n-ethylmaleimide-sensitive fusion protein

SCOP Domain Sequences for d1d2na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2na_ c.37.1.13 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus)}
edyasyimngiikwgdpvtrvlddgellvqqtknsdrtplvsvllegpphsgktalaaki
aeesnfpfikicspdkmigfsetakcqamkkifddayksqlscvvvddierlldyvpigp
rfsnlvlqallvllkkappqgrklliigttsrkdvlqememlnafsttihvpniatgeql
lealellgnfkdkerttiaqqvkgkkvwigikkllmliemslqmdpeyrvrkflallree
gaspld

SCOP Domain Coordinates for d1d2na_:

Click to download the PDB-style file with coordinates for d1d2na_.
(The format of our PDB-style files is described here.)

Timeline for d1d2na_: