SCOPe 2.06: Domain d5ks9h2: 5ks9 H:130-256

Lineage for d5ks9h2 (5ks9 H:130-256)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d5ks9h2: 5ks9 H:130-256 [324238]
   Other proteins in same PDB: d5ks9h1
   automated match to d3of6b2
   complexed with ca, nag

Details for d5ks9h2

PDB Entry: 5ks9, 2.55 Å

PDB Description: bel502-dq8-glia-alpha1 complex

PDB Compounds: (H:) Bel502 TCR beta TRBV9*01

SCOPe Domain Sequences for d5ks9h2:

Sequence; same for both SEQRES and ATOM records:

>d5ks9h2 b.1.1.2 (H:130-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgra

Timeline for d5ks9h2:

• d5ks9h2 is new in SCOPe 2.06-stable
  
• d5ks9h2 appears in SCOPe 2.07
  
• d5ks9h2 appears in the current release, SCOPe 2.08