SCOPe 2.08: Domain d5gvsb_: 5gvs B:

Lineage for d5gvsb_ (5gvs B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)

8. Domain d5gvsb_: 5gvs B: [324234]
   automated match to d2g9nb_

Details for d5gvsb_

PDB Entry: 5gvs, 2.2 Å

PDB Description: crystal structure of the ddx41 dead domain in an apo open form

PDB Compounds: (B:) Probable ATP-dependent RNA helicase DDX41

SCOPe Domain Sequences for d5gvsb_:

Sequence; same for both SEQRES and ATOM records:

>d5gvsb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emkfpaailrglkkkgihhptpiqiqgiptilsgrdmigiaftgsgktlvftlpvimfcl
eqekrlpfskregpygliicpsrelarqthgileyycrllqedsspllrcalciggmsvk
eqmetirhgvhmmvatpgrlmdllqkkmvsldicrylaldeadrmidmgfegdirtifsy
fkgqrqtllfsatmpkkiqnfaksalvkpvtinvg

Timeline for d5gvsb_:

• d5gvsb_ first appeared in SCOPe 2.06
  
• d5gvsb_ appears in SCOPe 2.07