SCOPe 2.08: Domain d5hobg_: 5hob G:

Lineage for d5hobg_ (5hob G:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
   core: 4 helices; bundle

4. Superfamily a.53.1: p53 tetramerization domain [47719] (2 families)
   homotetramer

5. Family a.53.1.0: automated matches [259188] (1 protein)
   not a true family

6. Protein automated matches [259190] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311354] (9 PDB entries)

8. Domain d5hobg_: 5hob G: [324209]
   Other proteins in same PDB: d5hobe2, d5hobh2
   automated match to d3zy1a_
   complexed with mg; mutant

Details for d5hobg_

PDB Entry: 5hob, 1.22 Å

PDB Description: p73 homo-tetramerization domain mutant i

PDB Compounds: (G:) Tumor protein p73

SCOPe Domain Sequences for d5hobg_:

Sequence; same for both SEQRES and ATOM records:

>d5hobg_ a.53.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dedtyylqvrgrknfeilmelkrslelmelvpqplvdsyeqqqqllq

Timeline for d5hobg_:

• d5hobg_ first appeared in SCOPe 2.06
  
• d5hobg_ appears in SCOPe 2.07